FOXO4-DRI 10mg
Research-grade FOXO4-DRI 10mg. 99% purity, third-party tested with published COA.
Ships from USA
1–3 day delivery
Free Shipping
On orders $150+
Peptide Handling & Storage Guide
Storage temperature, shelf life & reconstitution (PDF)
99%+ Purity
COA included
Same-Day Shipping
Orders before 2PM EST
Secure Checkout
SSL encrypted
Shipment Protection
Lost or damaged — reshipped free
Compound Information
- Type
- D-retro-inverso senolytic peptide (FOXO4–p53 disruptor)
- Molecular Formula
- C228H388N86O64
- Molecular Weight
- 5358 g/mol
- CAS Number
- 2460055-10-9
- Purity
- 99%
- Sequence
- all-D, reversed: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG
- Also known as
- Proxofim
Reference chemistry (free base) from public chemical databases and peer-reviewed literature. For laboratory research identification only.
Research Use Only. Not for human consumption. For laboratory and scientific research purposes only.
Research & References
Independent databases and peer-reviewed literature for FOXO4-DRI. Provided for research reference only.
External resources are independent and not affiliated with or endorsed by PHIOGEN. Listed for laboratory research reference only.
