PNC-27 30mg
Research-grade PNC-27 30mg. 99% purity, third-party tested with published COA.
Ships from USA
1–3 day delivery
Free Shipping
On orders $150+
Peptide Handling & Storage Guide
Storage temperature, shelf life & reconstitution (PDF)
99%+ Purity
COA included
Same-Day Shipping
Orders before 2PM EST
Secure Checkout
SSL encrypted
Shipment Protection
Lost or damaged — reshipped free
Compound Information
- Type
- Chimeric anticancer peptide (p53 + membrane-residency domain)
- Molecular Formula
- C188H293N53O44S
- Molecular Weight
- 4032 g/mol
- CAS Number
- 1159861-00-3
- Purity
- 99%
- Sequence
- PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG (p53 12-26 + penetratin)
Reference chemistry (free base) from public chemical databases and peer-reviewed literature. For laboratory research identification only.
Research Use Only. Not for human consumption. For laboratory and scientific research purposes only.
Research & References
Independent databases and peer-reviewed literature for PNC-27. Provided for research reference only.
External resources are independent and not affiliated with or endorsed by PHIOGEN. Listed for laboratory research reference only.
