
Sermorelin 5mg
Research-grade Sermorelin 5mg. 99% purity, third-party tested with published COA.
Ships from USA
1–3 day delivery
Free Shipping
On orders $150+
Peptide Handling & Storage Guide
Storage temperature, shelf life & reconstitution (PDF)
99%+ Purity
Research grade
Same-Day Shipping
Orders before 2PM EST
Secure Checkout
SSL encrypted
Shipment Protection
Lost or damaged — reshipped free
Compound Information
- Type
- GHRH analog — human GHRH(1-29) amide
- Molecular Formula
- C149H246N44O42S
- Molecular Weight
- 3357.9 g/mol
- CAS Number
- 86168-78-7
- Purity
- 99%
- Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
- Also known as
- GRF(1-29)NH2
Reference chemistry (free base) from public chemical databases and peer-reviewed literature. For laboratory research identification only.
Research Use Only. This vial is bound for the lab bench — supplied for in-vitro scientific work exclusively, never for administration to any person or animal.
Sermorelin 5mg
$43.00
Research & References
Independent databases and peer-reviewed literature for Sermorelin. Provided for research reference only.
External resources are independent and not affiliated with or endorsed by PHIOGEN. Listed for laboratory research reference only.



