
VIP 5mg
Research-grade VIP 5mg. 99% purity, third-party tested with published COA.
Ships from USA
1–3 day delivery
Free Shipping
On orders $150+
Peptide Handling & Storage Guide
Storage temperature, shelf life & reconstitution (PDF)
99%+ Purity
COA included
Same-Day Shipping
Orders before 2PM EST
Secure Checkout
SSL encrypted
Shipment Protection
Lost or damaged — reshipped free
Compound Information
- Type
- Vasoactive intestinal peptide (28-aa neuropeptide)
- Molecular Formula
- C147H237N43O43S
- Molecular Weight
- 3326.8 g/mol
- CAS Number
- 37221-79-7
- Purity
- 99%
- Sequence
- HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
- Also known as
- Vasoactive intestinal polypeptide
Reference chemistry (free base) from public chemical databases and peer-reviewed literature. For laboratory research identification only.
Research Use Only. Not for human consumption. For laboratory and scientific research purposes only.
Research & References
Independent databases and peer-reviewed literature for VIP. Provided for research reference only.
External resources are independent and not affiliated with or endorsed by PHIOGEN. Listed for laboratory research reference only.



